| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
| Protein Argininosuccinate synthetase, N-terminal domain [69458] (3 species) |
| Species Thermotoga maritima [TaxId:2336] [110493] (1 PDB entry) Uniprot Q9X2A1 |
| Domain d1vl2a1: 1vl2 A:2-169 [108708] Other proteins in same PDB: d1vl2a2, d1vl2b2, d1vl2c2, d1vl2d2 Structural genomics target |
PDB Entry: 1vl2 (more details), 1.65 Å
SCOPe Domain Sequences for d1vl2a1:
Sequence, based on SEQRES records: (download)
>d1vl2a1 c.26.2.1 (A:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
kekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikekalktgaskvyved
lrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekegaqyvahgatgkgn
dqvrfeltyaalnpnlkvispwkdpeflakfkgrtdlinyamekgipi
>d1vl2a1 c.26.2.1 (A:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
kekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikekalktgaskvyved
lrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekegaqyvahgatgkgn
dqvrfeltyaalnpnlkvispwkdpeflakfktdlinyamekgipi
Timeline for d1vl2a1: