Lineage for d1vl1a_ (1vl1 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2150965Family c.124.1.1: NagB-like [52513] (3 protein domains)
    share a common phosphate-binding site with the RpiA family
  6. 2150966Protein 6-phosphogluconolactonase [102321] (1 species)
  7. 2150967Species Thermotoga maritima [TaxId:2336] [102322] (2 PDB entries)
    Uniprot Q9X0N8 # TM1154
  8. 2150968Domain d1vl1a_: 1vl1 A: [108707]
    Structural genomics target
    complexed with cit

Details for d1vl1a_

PDB Entry: 1vl1 (more details), 1.55 Å

PDB Description: Crystal structure of 6-phosphogluconolactonase (TM1154) from Thermotoga maritima at 1.70A resolution
PDB Compounds: (A:) 6-phosphogluconolactonase

SCOPe Domain Sequences for d1vl1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vl1a_ c.124.1.1 (A:) 6-phosphogluconolactonase {Thermotoga maritima [TaxId: 2336]}
ktviylledgyvdfvvekirtkmeklleekdkifvvlaggrtplpvyeklaeqkfpwnri
hfflsderyvpldsdqsnfrninevlfsrakipsgnvhyvdtslpiekacekyereirsa
tdqfdlailgmgpdghvasifdletgnkdnlvtftdpsgdpkvprvtltfralntslyvl
flirgkekinrlteilkdtplpayfvrgkektvwfvgk

SCOPe Domain Coordinates for d1vl1a_:

Click to download the PDB-style file with coordinates for d1vl1a_.
(The format of our PDB-style files is described here.)

Timeline for d1vl1a_: