Lineage for d1vl0c_ (1vl0 C:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 477209Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (45 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 477380Protein DTDP-4-dehydrorhamnose reductase RfbD [110409] (1 species)
  7. 477381Species Clostridium acetobutylicum [TaxId:1488] [110410] (1 PDB entry)
  8. 477384Domain d1vl0c_: 1vl0 C: [108706]
    Structural genomics target

Details for d1vl0c_

PDB Entry: 1vl0 (more details), 2.05 Å

PDB Description: crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution

SCOP Domain Sequences for d1vl0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vl0c_ c.2.1.2 (C:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum}
hmkilitgangqlgreiqkqlkgknveviptdvqdlditnvlavnkffnekkpnvvinca
ahtavdkceeqydlaykinaigpknlaaaaysvgaeivqistdyvfdgeakepitefdev
npqsaygktklegenfvkalnpkyyivrtawlygdgnnfvktminlgkthdelkvvhdqv
gtptstvdlarvvlkvideknygtfhctckgicswydfaveifrltgidvkvtpctteef
prpakrpkysvlrnymlelttgditrewkeslkeyidllqm

SCOP Domain Coordinates for d1vl0c_:

Click to download the PDB-style file with coordinates for d1vl0c_.
(The format of our PDB-style files is described here.)

Timeline for d1vl0c_: