Lineage for d1vkzb3 (1vkz B:94-313)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511685Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 511686Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (7 families) (S)
  5. 511706Family d.142.1.2: BC ATP-binding domain-like [56067] (5 proteins)
  6. 511799Protein Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 [56070] (2 species)
  7. 511802Species Thermotoga maritima [TaxId:243274] [111187] (1 PDB entry)
  8. 511804Domain d1vkzb3: 1vkz B:94-313 [108703]
    Other proteins in same PDB: d1vkza1, d1vkza2, d1vkzb1, d1vkzb2
    Structural genomics target

Details for d1vkzb3

PDB Entry: 1vkz (more details), 2.3 Å

PDB Description: Crystal structure of Phosphoribosylamine--glycine ligase (TM1250) from Thermotoga maritima at 2.30 A resolution

SCOP Domain Sequences for d1vkzb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkzb3 d.142.1.2 (B:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima}
skvyakrfmkkygirtarfevaetpeelrekikkfsppyvikadglargkgvlildskee
tiekgskliigelikgvkgpvvideflagnelsamavvngrnfvilpfvrdykrlmdgdr
gpntggmgswgpveipsdtikkieelfdktlwgvekegyayrgflylglmlhdgdpyile
ynvrlgdpetevivtlnpegfvnavlegyrggkmepvepr

SCOP Domain Coordinates for d1vkzb3:

Click to download the PDB-style file with coordinates for d1vkzb3.
(The format of our PDB-style files is described here.)

Timeline for d1vkzb3: