Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins) |
Protein Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 [56070] (2 species) |
Species Thermotoga maritima [TaxId:2336] [111187] (1 PDB entry) Uniprot Q9X0X7 |
Domain d1vkza3: 1vkz A:94-313 [108700] Other proteins in same PDB: d1vkza1, d1vkza2, d1vkzb1, d1vkzb2 Structural genomics target complexed with edo |
PDB Entry: 1vkz (more details), 2.3 Å
SCOPe Domain Sequences for d1vkza3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} skvyakrfmkkygirtarfevaetpeelrekikkfsppyvikadglargkgvlildskee tiekgskliigelikgvkgpvvideflagnelsamavvngrnfvilpfvrdykrlmdgdr gpntggmgswgpveipsdtikkieelfdktlwgvekegyayrgflylglmlhdgdpyile ynvrlgdpetevivtlnpegfvnavlegyrggkmepvepr
Timeline for d1vkza3: