Lineage for d1vkza2 (1vkz A:4-93)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470137Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 2470281Protein Glycinamide ribonucleotide synthetase (GAR-syn), N-domain [52444] (2 species)
  7. 2470284Species Thermotoga maritima [TaxId:2336] [110500] (1 PDB entry)
    Uniprot Q9X0X7
  8. 2470285Domain d1vkza2: 1vkz A:4-93 [108699]
    Other proteins in same PDB: d1vkza1, d1vkza3, d1vkzb1, d1vkzb3
    Structural genomics target
    complexed with edo

Details for d1vkza2

PDB Entry: 1vkz (more details), 2.3 Å

PDB Description: Crystal structure of Phosphoribosylamine--glycine ligase (TM1250) from Thermotoga maritima at 2.30 A resolution
PDB Compounds: (A:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d1vkza2:

Sequence, based on SEQRES records: (download)

>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]}
vrvhilgsggrehaigwafakqgyevhfypgnagtkrdgtnhpyegektlkaipeedivi
pgseeflvegvsnwrsnvfgpvkevarleg

Sequence, based on observed residues (ATOM records): (download)

>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]}
vrvhilgsggrehaigwafakqgyevhfypgnagtkrdgtnhpyegektlkaipeedivi
pgseeflversnvfgpvkevarleg

SCOPe Domain Coordinates for d1vkza2:

Click to download the PDB-style file with coordinates for d1vkza2.
(The format of our PDB-style files is described here.)

Timeline for d1vkza2: