Lineage for d1vkyb_ (1vky B:)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 885838Fold e.53: QueA-like [111336] (1 superfamily)
    2 domains; d1 (1-64,174-335) [alpha/beta; 3 layers, a/b/a; mixed beta sheet of 9 strands, order: 219863457; strands 1, 5 and 8 are antiparallel to the rest]; d2 (65-142) [all-beta; barrel, closed (n=6, S=10); greek-key; topologically similar to the split barrel fold ((50474))
    2 domains; d1 (1-64,174-335) [alpha/beta; 3 layers, a/b/a; mixed beta sheet of 9 strands, order: 219863457; strands 1, 5 and 8 are antiparallel to the rest]; d2 (65-142) [all-beta; barrel, closed (n=6, S=10); greek-key; topologically similar to the split barrel fold ((50474))
  4. 885839Superfamily e.53.1: QueA-like [111337] (1 family) (S)
  5. 885840Family e.53.1.1: QueA-like [111338] (1 protein)
    Pfam PF02547
  6. 885841Protein Queuosine biosynthesis protein queA [111339] (2 species)
  7. 885842Species Thermotoga maritima [TaxId:2336] [111340] (1 PDB entry)
    Uniprot Q9WZ44
  8. 885844Domain d1vkyb_: 1vky B: [108697]
    Structural genomics target
    complexed with unl

Details for d1vkyb_

PDB Entry: 1vky (more details), 2 Å

PDB Description: Crystal structure of S-adenosylmethionine tRNA ribosyltransferase (TM0574) from Thermotoga maritima at 2.00 A resolution
PDB Compounds: (B:) S-adenosylmethionine:tRNA ribosyltransferase-isomerase

SCOP Domain Sequences for d1vkyb_:

Sequence, based on SEQRES records: (download)

>d1vkyb_ e.53.1.1 (B:) Queuosine biosynthesis protein queA {Thermotoga maritima [TaxId: 2336]}
sefdyelppeliaqepveprdasrlmvlhrktqriehrifreiieylepgdllvlnvskv
iparlyarkktgasieillierleegiwkclvrpgqkvkkgtelvidedlsavclgrged
gtrilkfqpqddrlifekgrtplppyiknevpleryqtvyakeegsvaaptaglhftpel
ieklkkkgvqfaevvlhvgigtfrpvkveevekhkmheefyqvpketvrklretrergnr
ivavgtttvrtletiarlpeqeeyvgktdlfiyppfefklvdalvtnfhlprstllmlva
afagkdfvmeayreavkrryrffsfgdamlil

Sequence, based on observed residues (ATOM records): (download)

>d1vkyb_ e.53.1.1 (B:) Queuosine biosynthesis protein queA {Thermotoga maritima [TaxId: 2336]}
sefdyelppeliaqepveprdasrlmvlhrktqriehrifreiieylepgdllvlnvskv
iparlyarkgasieillierleegiwkclvrpgqkvkkgtelvidedlsavclgrgedgt
rilkfqpqddrlifekgtaglhftpelieklkkkgvqfaevvlhvgiheefyqvpketvr
klretrergnrivavgtttvrtletiarlpeqeeyvgktdlfiyppfefklvdalvtnfh
lprstllmlvaafagkdfvmeayreavkrryrffsfgdamlil

SCOP Domain Coordinates for d1vkyb_:

Click to download the PDB-style file with coordinates for d1vkyb_.
(The format of our PDB-style files is described here.)

Timeline for d1vkyb_: