SCOPe 2.07: Domain d1vkwa1: 1vkw A:1-206

Lineage for d1vkwa1 (1vkw A:1-206)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families)

5. Family d.90.1.2: Putative nitroreductase TM1586 [111078] (1 protein)
   duplication: consists of two similar domains arranged as the subunits of the dimeric NADH oxidase/flavin reductase with one conserved active site

6. Protein Putative nitroreductase TM1586 [111079] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [111080] (1 PDB entry)
   Uniprot Q9X1S2

8. Domain d1vkwa1: 1vkw A:1-206 [108695]
   Other proteins in same PDB: d1vkwa2
   Structural genomics target
   complexed with so4

Details for d1vkwa1

PDB Entry: 1vkw, 2 Å

PDB Description: Crystal structure of a putative nitroreductase (tm1586) from thermotoga maritima msb8 at 2.00 A resolution

PDB Compounds: (A:) putative nitroreductase

SCOPe Domain Sequences for d1vkwa1:

Sequence; same for both SEQRES and ATOM records:

>d1vkwa1 d.90.1.2 (A:1-206) Putative nitroreductase TM1586 {Thermotoga maritima [TaxId: 2336]}
mnifeaienrhsvrdflerkmpervkddienllvkfitkkldwkinlssfpsyiyakaek
hfdelveygfqgeqivlfltaqgfgtcwmarsphpdvpyiivfgyprtrnftrkrrpits
flendleelppeivkivemtilapsalnrqpwkikytggelcisserpvdlgialshayl
tareifkrepviqkrgedtyclilnp

Timeline for d1vkwa1:

• d1vkwa1 first appeared in SCOP 1.69, called d1vkwa_
  
• d1vkwa1 appears in SCOPe 2.06
  
• d1vkwa1 appears in the current release, SCOPe 2.08