Lineage for d1vkwa1 (1vkw A:1-206)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528714Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2528715Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2528858Family d.90.1.2: Putative nitroreductase TM1586 [111078] (1 protein)
    duplication: consists of two similar domains arranged as the subunits of the dimeric NADH oxidase/flavin reductase with one conserved active site
  6. 2528859Protein Putative nitroreductase TM1586 [111079] (1 species)
  7. 2528860Species Thermotoga maritima [TaxId:2336] [111080] (1 PDB entry)
    Uniprot Q9X1S2
  8. 2528861Domain d1vkwa1: 1vkw A:1-206 [108695]
    Other proteins in same PDB: d1vkwa2
    Structural genomics target
    complexed with so4

Details for d1vkwa1

PDB Entry: 1vkw (more details), 2 Å

PDB Description: Crystal structure of a putative nitroreductase (tm1586) from thermotoga maritima msb8 at 2.00 A resolution
PDB Compounds: (A:) putative nitroreductase

SCOPe Domain Sequences for d1vkwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkwa1 d.90.1.2 (A:1-206) Putative nitroreductase TM1586 {Thermotoga maritima [TaxId: 2336]}
mnifeaienrhsvrdflerkmpervkddienllvkfitkkldwkinlssfpsyiyakaek
hfdelveygfqgeqivlfltaqgfgtcwmarsphpdvpyiivfgyprtrnftrkrrpits
flendleelppeivkivemtilapsalnrqpwkikytggelcisserpvdlgialshayl
tareifkrepviqkrgedtyclilnp

SCOPe Domain Coordinates for d1vkwa1:

Click to download the PDB-style file with coordinates for d1vkwa1.
(The format of our PDB-style files is described here.)

Timeline for d1vkwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vkwa2