![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
![]() | Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) ![]() |
![]() | Family d.90.1.2: Putative nitroreductase TM1586 [111078] (1 protein) duplication: consists of two similar domains arranged as the subunits of the dimeric NADH oxidase/flavin reductase with one conserved active site |
![]() | Protein Putative nitroreductase TM1586 [111079] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [111080] (1 PDB entry) Uniprot Q9X1S2 |
![]() | Domain d1vkwa1: 1vkw A:1-206 [108695] Other proteins in same PDB: d1vkwa2 Structural genomics target complexed with so4 |
PDB Entry: 1vkw (more details), 2 Å
SCOPe Domain Sequences for d1vkwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vkwa1 d.90.1.2 (A:1-206) Putative nitroreductase TM1586 {Thermotoga maritima [TaxId: 2336]} mnifeaienrhsvrdflerkmpervkddienllvkfitkkldwkinlssfpsyiyakaek hfdelveygfqgeqivlfltaqgfgtcwmarsphpdvpyiivfgyprtrnftrkrrpits flendleelppeivkivemtilapsalnrqpwkikytggelcisserpvdlgialshayl tareifkrepviqkrgedtyclilnp
Timeline for d1vkwa1: