Lineage for d1vkva2 (1vkv A:196-351)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598122Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 598123Superfamily d.13.1: HIT-like [54197] (3 families) (S)
  5. 598172Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
    duplication: consists of 2 HIT-like motifs
    binds zinc and iron ions
  6. 598173Protein Galactose-1-phosphate uridylyltransferase [54208] (2 species)
  7. 598199Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110788] (1 PDB entry)
  8. 598201Domain d1vkva2: 1vkv A:196-351 [108692]

Details for d1vkva2

PDB Entry: 1vkv (more details), 2.3 Å

PDB Description: X-ray Structure of Gene Product from Arabidopsis Thaliana At5g18200

SCOP Domain Sequences for d1vkva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkva2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana)}
pptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapfaatypfeiwiipkdh
sshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplkvtesqlpythwflqi
vpqlsgvggfeigtgcyinpvfpedvakvmrevslt

SCOP Domain Coordinates for d1vkva2:

Click to download the PDB-style file with coordinates for d1vkva2.
(The format of our PDB-style files is described here.)

Timeline for d1vkva2:

Domains from same chain:
(mouse over for more information)
d1vkva1
Domains from other chains:
(mouse over for more information)
d1vkvb1, d1vkvb2