Lineage for d1vkva1 (1vkv A:23-195)
- Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds) 
Fold d.13: HIT-like [54196] (2 superfamilies)
alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alphaSuperfamily d.13.1: HIT-like [54197] (3 families) 
Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
duplication: consists of 2 HIT-like motifs
binds zinc and iron ionsProtein Galactose-1-phosphate uridylyltransferase [54208] (2 species) 
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110788] (1 PDB entry) 
Domain d1vkva1: 1vkv A:23-195 [108691]
Details for d1vkva1
PDB Entry: 1vkv (more details), 2.3 Å
PDB Description: X-ray Structure of Gene Product from Arabidopsis Thaliana At5g18200
SCOP Domain Sequences for d1vkva1:
Sequence, based on SEQRES records: (download)
>d1vkva1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana)}
pelrkdpvtnrwvifspxxxxxxxxxxxxxxxxxxxxxxscpfcigreqecapelfrvpd
hdpnwklrvienlypalsrnletqstqpetgtsrtivgfgfhdvviespvhsiqlsdidp
vgigdiliaykkrinqiaqhdsinyiqvfknqgasagasmshshsqmmalpvv
Sequence, based on observed residues (ATOM records): (download)
>d1vkva1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana)}
pelrkdpvtnrwvifspxxxxxxscpfcigreqecapelfrvpdhdpnwklrvienlypa
lsrnletrtivgfgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyi
qvfknqgasagasmshshsqmmalpvv
SCOP Domain Coordinates for d1vkva1:
Click to download the PDB-style file with coordinates for d1vkva1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vkva1:
- d1vkva1 first appeared in SCOP 1.69
- d1vkva1 does not appear in SCOP 1.73
View in 3D
