![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (3 families) ![]() |
![]() | Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein) duplication: consists of 2 HIT-like motifs binds zinc and iron ions |
![]() | Protein Galactose-1-phosphate uridylyltransferase [54208] (2 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110788] (1 PDB entry) |
![]() | Domain d1vkva1: 1vkv A:23-195 [108691] |
PDB Entry: 1vkv (more details), 2.3 Å
SCOP Domain Sequences for d1vkva1:
Sequence, based on SEQRES records: (download)
>d1vkva1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana)} pelrkdpvtnrwvifspxxxxxxxxxxxxxxxxxxxxxxscpfcigreqecapelfrvpd hdpnwklrvienlypalsrnletqstqpetgtsrtivgfgfhdvviespvhsiqlsdidp vgigdiliaykkrinqiaqhdsinyiqvfknqgasagasmshshsqmmalpvv
>d1vkva1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana)} pelrkdpvtnrwvifspxxxxxxscpfcigreqecapelfrvpdhdpnwklrvienlypa lsrnletrtivgfgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyi qvfknqgasagasmshshsqmmalpvv
Timeline for d1vkva1: