Lineage for d1vkva1 (1vkv A:23-195)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499160Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 499161Superfamily d.13.1: HIT-like [54197] (3 families) (S)
  5. 499199Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
    duplication: consists of 2 HIT-like motifs
    binds zinc and iron ions
  6. 499200Protein Galactose-1-phosphate uridylyltransferase [54208] (2 species)
  7. 499226Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110788] (1 PDB entry)
  8. 499227Domain d1vkva1: 1vkv A:23-195 [108691]

Details for d1vkva1

PDB Entry: 1vkv (more details), 2.3 Å

PDB Description: X-ray Structure of Gene Product from Arabidopsis Thaliana At5g18200

SCOP Domain Sequences for d1vkva1:

Sequence, based on SEQRES records: (download)

>d1vkva1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana)}
pelrkdpvtnrwvifspxxxxxxxxxxxxxxxxxxxxxxscpfcigreqecapelfrvpd
hdpnwklrvienlypalsrnletqstqpetgtsrtivgfgfhdvviespvhsiqlsdidp
vgigdiliaykkrinqiaqhdsinyiqvfknqgasagasmshshsqmmalpvv

Sequence, based on observed residues (ATOM records): (download)

>d1vkva1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana)}
pelrkdpvtnrwvifspxxxxxxscpfcigreqecapelfrvpdhdpnwklrvienlypa
lsrnletrtivgfgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyi
qvfknqgasagasmshshsqmmalpvv

SCOP Domain Coordinates for d1vkva1:

Click to download the PDB-style file with coordinates for d1vkva1.
(The format of our PDB-style files is described here.)

Timeline for d1vkva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vkva2