Lineage for d1vkqa_ (1vkq A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544466Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 544467Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 544472Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 544473Protein Phospholipase A2 [48637] (4 species)
  7. 544474Species Cow (Bos taurus), pancreas [TaxId:9913] [48639] (25 PDB entries)
  8. 544478Domain d1vkqa_: 1vkq A: [108688]
    complexed with ca, cl, mpd; mutant

Details for d1vkqa_

PDB Entry: 1vkq (more details), 1.6 Å

PDB Description: a re-determination of the structure of the triple mutant (k53,56,120m) of phospholipase a2 at 1.6a resolution using sulphur-sas at 1.54a wavelength

SCOP Domain Sequences for d1vkqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkqa_ a.133.1.2 (A:) Phospholipase A2 {Cow (Bos taurus), pancreas}
alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldm
knc

SCOP Domain Coordinates for d1vkqa_:

Click to download the PDB-style file with coordinates for d1vkqa_.
(The format of our PDB-style files is described here.)

Timeline for d1vkqa_: