Lineage for d1vkqa_ (1vkq A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2732922Protein Phospholipase A2 [48637] (5 species)
  7. 2732923Species Cow (Bos taurus), pancreas [TaxId:9913] [48639] (32 PDB entries)
    Uniprot P00593
  8. 2732941Domain d1vkqa_: 1vkq A: [108688]
    complexed with ca, cl, mpd; mutant

Details for d1vkqa_

PDB Entry: 1vkq (more details), 1.6 Å

PDB Description: a re-determination of the structure of the triple mutant (k53,56,120m) of phospholipase a2 at 1.6a resolution using sulphur-sas at 1.54a wavelength
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1vkqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkqa_ a.133.1.2 (A:) Phospholipase A2 {Cow (Bos taurus), pancreas [TaxId: 9913]}
alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldm
knc

SCOPe Domain Coordinates for d1vkqa_:

Click to download the PDB-style file with coordinates for d1vkqa_.
(The format of our PDB-style files is described here.)

Timeline for d1vkqa_: