Lineage for d1vkpa_ (1vkp A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510635Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 510636Superfamily d.126.1: Pentein [55909] (6 families) (S)
  5. 510684Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase (Pfam 04371) [111155] (2 proteins)
    functionally related to the amidinotransferase, similar active site
  6. 510685Protein Agmatine iminohydrolase [111156] (1 species)
  7. 510686Species Thale-cress (Arabidopsis thaliana) [TaxId:3702] [111157] (1 PDB entry)
  8. 510687Domain d1vkpa_: 1vkp A: [108686]

Details for d1vkpa_

PDB Entry: 1vkp (more details), 1.53 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at5g08170, agmatine iminohydrolase

SCOP Domain Sequences for d1vkpa_:

Sequence, based on SEQRES records: (download)

>d1vkpa_ d.126.1.6 (A:) Agmatine iminohydrolase {Thale-cress (Arabidopsis thaliana)}
respaehgyympaewdshaqtwigwperqdnwrhnalpaqrvfagvakaiskfepvtvca
spaqwenarkqlpedirvvemsmndswfrdsgptfivrkrpvklsslnrniagidwnfna
wggandgcyndwshdllvsrkilaleriprfqhsmileggsihvdgegtclvteecllnk
nrnphmskeqieeelkkylgvqsfiwlprglygdedtnghidnmccfarpgvvllswtdd
etdpqyersvealsvlsnsidargrkiqviklyipeplymteeessgitqdgeaiprlag
trlaasyvnfyianggiiapqfgdpirdkeairvlsdtfphhsvvgienareivlaggni
hcitqqqpaept

Sequence, based on observed residues (ATOM records): (download)

>d1vkpa_ d.126.1.6 (A:) Agmatine iminohydrolase {Thale-cress (Arabidopsis thaliana)}
respaehgyympaewdshaqtwigwperqdnwrhnalpaqrvfagvakaiskfepvtvca
spaqwenarkqlpedirvvemsmndswfrdsgptfivrkrnrniagidwnfnawggandg
cyndwshdllvsrkilaleriprfqhsmileggsihvdgegtclvteecllnknrnphms
keqieeelkkylgvqsfiwlprglygdedtnghidnmccfarpgvvllswtddetdpqye
rsvealsvlsnsidargrkiqviklyipeplymteeessgitqdgeaiprlagtrlaasy
vnfyianggiiapqfgdpirdkeairvlsdtfphhsvvgienareivlaggnihcitqqq
paept

SCOP Domain Coordinates for d1vkpa_:

Click to download the PDB-style file with coordinates for d1vkpa_.
(The format of our PDB-style files is described here.)

Timeline for d1vkpa_: