Lineage for d1vkpa_ (1vkp A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537906Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2537907Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2537992Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins)
    Pfam PF04371; functionally related to the amidinotransferase, similar active site
  6. 2537993Protein Agmatine iminohydrolase [111156] (3 species)
  7. 2538005Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111157] (1 PDB entry)
    Uniprot Q8GWW7
  8. 2538006Domain d1vkpa_: 1vkp A: [108686]
    Structural genomics target
    complexed with edo, mg, mpo

Details for d1vkpa_

PDB Entry: 1vkp (more details), 1.53 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at5g08170, agmatine iminohydrolase
PDB Compounds: (A:) agmatine iminohydrolase

SCOPe Domain Sequences for d1vkpa_:

Sequence, based on SEQRES records: (download)

>d1vkpa_ d.126.1.6 (A:) Agmatine iminohydrolase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
respaehgyympaewdshaqtwigwperqdnwrhnalpaqrvfagvakaiskfepvtvca
spaqwenarkqlpedirvvemsmndswfrdsgptfivrkrpvklsslnrniagidwnfna
wggandgcyndwshdllvsrkilaleriprfqhsmileggsihvdgegtclvteecllnk
nrnphmskeqieeelkkylgvqsfiwlprglygdedtnghidnmccfarpgvvllswtdd
etdpqyersvealsvlsnsidargrkiqviklyipeplymteeessgitqdgeaiprlag
trlaasyvnfyianggiiapqfgdpirdkeairvlsdtfphhsvvgienareivlaggni
hcitqqqpaept

Sequence, based on observed residues (ATOM records): (download)

>d1vkpa_ d.126.1.6 (A:) Agmatine iminohydrolase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
respaehgyympaewdshaqtwigwperqdnwrhnalpaqrvfagvakaiskfepvtvca
spaqwenarkqlpedirvvemsmndswfrdsgptfivrkrnrniagidwnfnawggandg
cyndwshdllvsrkilaleriprfqhsmileggsihvdgegtclvteecllnknrnphms
keqieeelkkylgvqsfiwlprglygdedtnghidnmccfarpgvvllswtddetdpqye
rsvealsvlsnsidargrkiqviklyipeplymteeessgitqdgeaiprlagtrlaasy
vnfyianggiiapqfgdpirdkeairvlsdtfphhsvvgienareivlaggnihcitqqq
paept

SCOPe Domain Coordinates for d1vkpa_:

Click to download the PDB-style file with coordinates for d1vkpa_.
(The format of our PDB-style files is described here.)

Timeline for d1vkpa_: