Lineage for d1vkoa2 (1vko A:315-428)
- Root: SCOP 1.69
Class d: Alpha and beta proteins (a+b) [53931] (279 folds) 
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) 
N-terminal domain is the classic Rossmann-fold
Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) 
Protein Myo-inositol 1-phosphate synthase [75484] (4 species) 
Species Caenorhabditis elegans [111050] (1 PDB entry) 
Domain d1vkoa2: 1vko A:315-428 [108685]
Other proteins in same PDB: d1vkoa1
Structural genomics target
Details for d1vkoa2
PDB Entry: 1vko (more details), 2.3 Å
PDB Description: crystal structure of inositol-3-phosphate synthase (ce21227) from caenorhabditis elegans at 2.30 a resolution
SCOP Domain Sequences for d1vkoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vkoa2 d.81.1.3 (A:315-428) Myo-inositol 1-phosphate synthase {Caenorhabditis elegans}
sgqtkfksafvdflvssgmkpesivsynhlgnndgknlsearqfrskeiskssvvddmvk
snqilfpdaknpdycvvikyvpyvadskramdeyicsifmggkqtfvvhntced
SCOP Domain Coordinates for d1vkoa2:
Click to download the PDB-style file with coordinates for d1vkoa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vkoa2:
- d1vkoa2 is new in SCOP 1.69
- d1vkoa2 appears in SCOP 1.71
- d1vkoa2 appears in the current release, SCOPe 2.08
View in 3D
