Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) |
Protein Myo-inositol 1-phosphate synthase [75484] (4 species) |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [111050] (1 PDB entry) Uniprot Q18664 |
Domain d1vkoa2: 1vko A:315-428 [108685] Other proteins in same PDB: d1vkoa1 Structural genomics target complexed with cl, iod, k, nad, pop |
PDB Entry: 1vko (more details), 2.3 Å
SCOPe Domain Sequences for d1vkoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vkoa2 d.81.1.3 (A:315-428) Myo-inositol 1-phosphate synthase {Nematode (Caenorhabditis elegans) [TaxId: 6239]} sgqtkfksafvdflvssgmkpesivsynhlgnndgknlsearqfrskeiskssvvddmvk snqilfpdaknpdycvvikyvpyvadskramdeyicsifmggkqtfvvhntced
Timeline for d1vkoa2: