Lineage for d1vkoa2 (1vko A:315-428)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2962012Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2962094Protein Myo-inositol 1-phosphate synthase [75484] (4 species)
  7. 2962127Species Nematode (Caenorhabditis elegans) [TaxId:6239] [111050] (1 PDB entry)
    Uniprot Q18664
  8. 2962128Domain d1vkoa2: 1vko A:315-428 [108685]
    Other proteins in same PDB: d1vkoa1
    Structural genomics target
    complexed with cl, iod, k, nad, pop

Details for d1vkoa2

PDB Entry: 1vko (more details), 2.3 Å

PDB Description: crystal structure of inositol-3-phosphate synthase (ce21227) from caenorhabditis elegans at 2.30 a resolution
PDB Compounds: (A:) Inositol-3-phosphate synthase

SCOPe Domain Sequences for d1vkoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkoa2 d.81.1.3 (A:315-428) Myo-inositol 1-phosphate synthase {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
sgqtkfksafvdflvssgmkpesivsynhlgnndgknlsearqfrskeiskssvvddmvk
snqilfpdaknpdycvvikyvpyvadskramdeyicsifmggkqtfvvhntced

SCOPe Domain Coordinates for d1vkoa2:

Click to download the PDB-style file with coordinates for d1vkoa2.
(The format of our PDB-style files is described here.)

Timeline for d1vkoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vkoa1