![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Myo-inositol 1-phosphate synthase [75105] (4 species) |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110419] (1 PDB entry) Uniprot Q18664 |
![]() | Domain d1vkoa1: 1vko A:11-314,A:429-521 [108684] Other proteins in same PDB: d1vkoa2 Structural genomics target complexed with cl, iod, k, nad, pop has additional subdomain(s) that are not in the common domain |
PDB Entry: 1vko (more details), 2.3 Å
SCOPe Domain Sequences for d1vkoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vkoa1 c.2.1.3 (A:11-314,A:429-521) Myo-inositol 1-phosphate synthase {Nematode (Caenorhabditis elegans) [TaxId: 6239]} krlivespnvkledgvlesrftyrknhfehradglhvtpkehdysfktvlkprktglllv glggnngstavgsifanqyamtwrtkeghsqanyfgsvtqtatvhlgydsatqnqifvpf kdivpilspndliisgwdisdsnlyeamgrakvfepelqeklrpfmepivplpsiyypdf iasnqgdrannvipgdnklehlehiradirkfkqehelecvivlwtanterytdvrqgln atadeimesirvnedevspsnifavasilegahyingspqntlvpglielaerhkvfvgg ddfkXsllaspliydlailtelasrvsykvddeykpfhsvlsilslllkapvvppgtpis nafmrqfstltklvtalagfpsdtdmqiefftqlpaak
Timeline for d1vkoa1: