Lineage for d1vkoa1 (1vko A:11-314,A:429-521)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2844066Protein Myo-inositol 1-phosphate synthase [75105] (4 species)
  7. 2844099Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110419] (1 PDB entry)
    Uniprot Q18664
  8. 2844100Domain d1vkoa1: 1vko A:11-314,A:429-521 [108684]
    Other proteins in same PDB: d1vkoa2
    Structural genomics target
    complexed with cl, iod, k, nad, pop

    has additional subdomain(s) that are not in the common domain

Details for d1vkoa1

PDB Entry: 1vko (more details), 2.3 Å

PDB Description: crystal structure of inositol-3-phosphate synthase (ce21227) from caenorhabditis elegans at 2.30 a resolution
PDB Compounds: (A:) Inositol-3-phosphate synthase

SCOPe Domain Sequences for d1vkoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkoa1 c.2.1.3 (A:11-314,A:429-521) Myo-inositol 1-phosphate synthase {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
krlivespnvkledgvlesrftyrknhfehradglhvtpkehdysfktvlkprktglllv
glggnngstavgsifanqyamtwrtkeghsqanyfgsvtqtatvhlgydsatqnqifvpf
kdivpilspndliisgwdisdsnlyeamgrakvfepelqeklrpfmepivplpsiyypdf
iasnqgdrannvipgdnklehlehiradirkfkqehelecvivlwtanterytdvrqgln
atadeimesirvnedevspsnifavasilegahyingspqntlvpglielaerhkvfvgg
ddfkXsllaspliydlailtelasrvsykvddeykpfhsvlsilslllkapvvppgtpis
nafmrqfstltklvtalagfpsdtdmqiefftqlpaak

SCOPe Domain Coordinates for d1vkoa1:

Click to download the PDB-style file with coordinates for d1vkoa1.
(The format of our PDB-style files is described here.)

Timeline for d1vkoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vkoa2