SCOP 1.71: Domain d1vknd2: 1vkn D:145-307

Lineage for d1vknd2 (1vkn D:145-307)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (4 proteins)
   has many additional secondary structures

6. Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [111046] (2 species)

7. Species Thermotoga maritima [TaxId:243274] [111047] (1 PDB entry)

8. Domain d1vknd2: 1vkn D:145-307 [108683]
   Other proteins in same PDB: d1vkna1, d1vknb1, d1vknc1, d1vknd1
   Structural genomics target

Details for d1vknd2

PDB Entry: 1vkn, 1.8 Å

PDB Description: Crystal structure of N-acetyl-gamma-glutamyl-phosphate reductase (TM1782) from Thermotoga maritima at 1.80 A resolution

SCOP Domain Sequences for d1vknd2:

Sequence, based on SEQRES records:

>d1vknd2 d.81.1.1 (D:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima}
cyptsvilalapalkhnlvdpetilvdaksgvsgagrkekvdylfsevneslrpynvakh
rhvpemeqelgkisgkkvnvvftphlvpmtrgilstiyvktdksleeiheaylefyknep
fvhvlpmgiypstkwcygsnhvfigmqmeertntlilmsaidn

Sequence, based on observed residues (ATOM records):

>d1vknd2 d.81.1.1 (D:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima}
cyptsvilalapalkhnlvdpetilvdaksgvsgekvdylfsevneslrpynvakhrhvp
emeqelgkisgkkvnvvftphlvpmtrgilstiyvktdksleeiheaylefyknepfvhv
lpmgiypstkwcygsnhvfigmqmeertntlilmsaidn

Timeline for d1vknd2:

• d1vknd2 first appeared in SCOP 1.69
  
• d1vknd2 appears in SCOP 1.73
  
• d1vknd2 appears in the current release, SCOPe 2.08