Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (4 proteins) has many additional secondary structures |
Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [111046] (2 species) |
Species Thermotoga maritima [TaxId:243274] [111047] (1 PDB entry) |
Domain d1vknd2: 1vkn D:145-307 [108683] Other proteins in same PDB: d1vkna1, d1vknb1, d1vknc1, d1vknd1 Structural genomics target |
PDB Entry: 1vkn (more details), 1.8 Å
SCOP Domain Sequences for d1vknd2:
Sequence, based on SEQRES records: (download)
>d1vknd2 d.81.1.1 (D:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima} cyptsvilalapalkhnlvdpetilvdaksgvsgagrkekvdylfsevneslrpynvakh rhvpemeqelgkisgkkvnvvftphlvpmtrgilstiyvktdksleeiheaylefyknep fvhvlpmgiypstkwcygsnhvfigmqmeertntlilmsaidn
>d1vknd2 d.81.1.1 (D:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima} cyptsvilalapalkhnlvdpetilvdaksgvsgekvdylfsevneslrpynvakhrhvp emeqelgkisgkkvnvvftphlvpmtrgilstiyvktdksleeiheaylefyknepfvhv lpmgiypstkwcygsnhvfigmqmeertntlilmsaidn
Timeline for d1vknd2: