Lineage for d1vknd1 (1vkn D:1-144,D:308-339)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1829165Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [110423] (3 species)
  7. 1829177Species Thermotoga maritima [TaxId:2336] [110424] (1 PDB entry)
    Uniprot Q9X2A2
  8. 1829181Domain d1vknd1: 1vkn D:1-144,D:308-339 [108682]
    Other proteins in same PDB: d1vkna2, d1vknb2, d1vknc2, d1vknd2
    Structural genomics target

Details for d1vknd1

PDB Entry: 1vkn (more details), 1.8 Å

PDB Description: Crystal structure of N-acetyl-gamma-glutamyl-phosphate reductase (TM1782) from Thermotoga maritima at 1.80 A resolution
PDB Compounds: (D:) N-acetyl-gamma-glutamyl-phosphate reductase

SCOPe Domain Sequences for d1vknd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vknd1 c.2.1.3 (D:1-144,D:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]}
miragiigatgytglelvrllknhpeakitylssrtyagkkleeifpstlensilsefdp
ekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyrewygkelsgyeni
krvyglpelhreeiknaqvvgnpgXlvkgasgqavqnmnimfgldetkgleftpiyp

SCOPe Domain Coordinates for d1vknd1:

Click to download the PDB-style file with coordinates for d1vknd1.
(The format of our PDB-style files is described here.)

Timeline for d1vknd1: