Lineage for d1vknc2 (1vkn C:145-307)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506899Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 506900Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 506901Family d.81.1.1: GAPDH-like [55348] (4 proteins)
    has many additional secondary structures
  6. 507109Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [111046] (1 species)
  7. 507110Species Thermotoga maritima [TaxId:243274] [111047] (1 PDB entry)
  8. 507113Domain d1vknc2: 1vkn C:145-307 [108681]
    Other proteins in same PDB: d1vkna1, d1vknb1, d1vknc1, d1vknd1

Details for d1vknc2

PDB Entry: 1vkn (more details), 1.8 Å

PDB Description: Crystal structure of N-acetyl-gamma-glutamyl-phosphate reductase (TM1782) from Thermotoga maritima at 1.80 A resolution

SCOP Domain Sequences for d1vknc2:

Sequence, based on SEQRES records: (download)

>d1vknc2 d.81.1.1 (C:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima}
cyptsvilalapalkhnlvdpetilvdaksgvsgagrkekvdylfsevneslrpynvakh
rhvpemeqelgkisgkkvnvvftphlvpmtrgilstiyvktdksleeiheaylefyknep
fvhvlpmgiypstkwcygsnhvfigmqmeertntlilmsaidn

Sequence, based on observed residues (ATOM records): (download)

>d1vknc2 d.81.1.1 (C:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima}
cyptsvilalapalkhnlvdpetilvdaksgvsgaekvdylfsevneslrpynvakhrhv
pemeqelgkisgkkvnvvftphlvpmtrgilstiyvktdksleeiheaylefyknepfvh
vlpmgiypstkwcygsnhvfigmqmeertntlilmsaidn

SCOP Domain Coordinates for d1vknc2:

Click to download the PDB-style file with coordinates for d1vknc2.
(The format of our PDB-style files is described here.)

Timeline for d1vknc2: