Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [110423] (3 species) |
Species Thermotoga maritima [TaxId:2336] [110424] (1 PDB entry) Uniprot Q9X2A2 |
Domain d1vknc1: 1vkn C:1-144,C:308-339 [108680] Other proteins in same PDB: d1vkna2, d1vknb2, d1vknc2, d1vknd2 Structural genomics target |
PDB Entry: 1vkn (more details), 1.8 Å
SCOPe Domain Sequences for d1vknc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vknc1 c.2.1.3 (C:1-144,C:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} miragiigatgytglelvrllknhpeakitylssrtyagkkleeifpstlensilsefdp ekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyrewygkelsgyeni krvyglpelhreeiknaqvvgnpgXlvkgasgqavqnmnimfgldetkgleftpiyp
Timeline for d1vknc1: