Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [111046] (3 species) |
Species Thermotoga maritima [TaxId:2336] [111047] (1 PDB entry) Uniprot Q9X2A2 |
Domain d1vknb2: 1vkn B:145-307 [108679] Other proteins in same PDB: d1vkna1, d1vknb1, d1vknc1, d1vknd1 Structural genomics target |
PDB Entry: 1vkn (more details), 1.8 Å
SCOPe Domain Sequences for d1vknb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vknb2 d.81.1.1 (B:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} cyptsvilalapalkhnlvdpetilvdaksgvsgagrkekvdylfsevneslrpynvakh rhvpemeqelgkisgkkvnvvftphlvpmtrgilstiyvktdksleeiheaylefyknep fvhvlpmgiypstkwcygsnhvfigmqmeertntlilmsaidn
Timeline for d1vknb2: