Lineage for d1vknb2 (1vkn B:145-307)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [111046] (3 species)
  7. Species Thermotoga maritima [TaxId:2336] [111047] (1 PDB entry)
    Uniprot Q9X2A2
  8. Domain d1vknb2: 1vkn B:145-307 [108679]
    Other proteins in same PDB: d1vkna1, d1vkna3, d1vknb1, d1vknb3, d1vknc1, d1vknd1
    Structural genomics target

Details for d1vknb2

PDB Entry: 1vkn (more details), 1.8 Å

PDB Description: Crystal structure of N-acetyl-gamma-glutamyl-phosphate reductase (TM1782) from Thermotoga maritima at 1.80 A resolution
PDB Compounds: (B:) N-acetyl-gamma-glutamyl-phosphate reductase

SCOPe Domain Sequences for d1vknb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vknb2 d.81.1.1 (B:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]}
cyptsvilalapalkhnlvdpetilvdaksgvsgagrkekvdylfsevneslrpynvakh
rhvpemeqelgkisgkkvnvvftphlvpmtrgilstiyvktdksleeiheaylefyknep
fvhvlpmgiypstkwcygsnhvfigmqmeertntlilmsaidn

SCOPe Domain Coordinates for d1vknb2 are not available.

Timeline for d1vknb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vknb1, d1vknb3
View in 3D
Domains from other chains:
(mouse over for more information)
d1vkna1, d1vkna2, d1vkna3, d1vknc1, d1vknc2, d1vknd1, d1vknd2