Lineage for d1vkna2 (1vkn A:145-307)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1915721Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1916056Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [111046] (3 species)
  7. 1916068Species Thermotoga maritima [TaxId:2336] [111047] (1 PDB entry)
    Uniprot Q9X2A2
  8. 1916069Domain d1vkna2: 1vkn A:145-307 [108677]
    Other proteins in same PDB: d1vkna1, d1vknb1, d1vknc1, d1vknd1
    Structural genomics target

Details for d1vkna2

PDB Entry: 1vkn (more details), 1.8 Å

PDB Description: Crystal structure of N-acetyl-gamma-glutamyl-phosphate reductase (TM1782) from Thermotoga maritima at 1.80 A resolution
PDB Compounds: (A:) N-acetyl-gamma-glutamyl-phosphate reductase

SCOPe Domain Sequences for d1vkna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkna2 d.81.1.1 (A:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]}
cyptsvilalapalkhnlvdpetilvdaksgvsgagrkekvdylfsevneslrpynvakh
rhvpemeqelgkisgkkvnvvftphlvpmtrgilstiyvktdksleeiheaylefyknep
fvhvlpmgiypstkwcygsnhvfigmqmeertntlilmsaidn

SCOPe Domain Coordinates for d1vkna2:

Click to download the PDB-style file with coordinates for d1vkna2.
(The format of our PDB-style files is described here.)

Timeline for d1vkna2: