Lineage for d1vkmf_ (1vkm F:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 595641Fold c.138: Indigoidine synthase A-like [110580] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 7 strands, order 2134756
  4. 595642Superfamily c.138.1: Indigoidine synthase A-like [110581] (1 family) (S)
  5. 595643Family c.138.1.1: Indigoidine synthase A-like [110582] (1 protein)
    Pfam 04227
  6. 595644Protein Hypothetical protein TM1464 [110583] (1 species)
  7. 595645Species Thermotoga maritima [TaxId:243274] [110584] (1 PDB entry)
  8. 595651Domain d1vkmf_: 1vkm F: [108675]
    Structural genomics target
    complexed with edo, mn, unl

Details for d1vkmf_

PDB Entry: 1vkm (more details), 1.9 Å

PDB Description: Crystal structure of an indigoidine synthase a (idga)-like protein (tm1464) from thermotoga maritima msb8 at 1.90 A resolution

SCOP Domain Sequences for d1vkmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkmf_ c.138.1.1 (F:) Hypothetical protein TM1464 {Thermotoga maritima}
kihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfqlavig
ilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrigievv
vtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvgfrtn
efplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdeierll
ekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkr

SCOP Domain Coordinates for d1vkmf_:

Click to download the PDB-style file with coordinates for d1vkmf_.
(The format of our PDB-style files is described here.)

Timeline for d1vkmf_: