Lineage for d1vkmb_ (1vkm B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 496744Fold c.138: Indigoidine synthase A-like (Pfam 04227) [110580] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 7 strands, order 2134756
  4. 496745Superfamily c.138.1: Indigoidine synthase A-like (Pfam 04227) [110581] (1 family) (S)
  5. 496746Family c.138.1.1: Indigoidine synthase A-like (Pfam 04227) [110582] (1 protein)
  6. 496747Protein Hypothetical protein TM1464 [110583] (1 species)
  7. 496748Species Thermotoga maritima [TaxId:243274] [110584] (1 PDB entry)
  8. 496750Domain d1vkmb_: 1vkm B: [108671]

Details for d1vkmb_

PDB Entry: 1vkm (more details), 1.9 Å

PDB Description: Crystal structure of an indigoidine synthase a (idga)-like protein (tm1464) from thermotoga maritima msb8 at 1.90 A resolution

SCOP Domain Sequences for d1vkmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkmb_ c.138.1.1 (B:) Hypothetical protein TM1464 {Thermotoga maritima}
kihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfqlavig
ilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrigievv
vtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvgfrtn
efplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdeierll
ekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkr

SCOP Domain Coordinates for d1vkmb_:

Click to download the PDB-style file with coordinates for d1vkmb_.
(The format of our PDB-style files is described here.)

Timeline for d1vkmb_: