Lineage for d1vkma1 (1vkm A:1-284)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923422Fold c.138: Indigoidine synthase A-like [110580] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 7 strands, order 2134756
  4. 2923423Superfamily c.138.1: Indigoidine synthase A-like [110581] (1 family) (S)
    automatically mapped to Pfam PF04227
  5. 2923424Family c.138.1.1: Indigoidine synthase A-like [110582] (1 protein)
    Pfam PF04227
  6. 2923425Protein Hypothetical protein TM1464 [110583] (1 species)
  7. 2923426Species Thermotoga maritima [TaxId:2336] [110584] (1 PDB entry)
    Uniprot Q9X1H5
  8. 2923427Domain d1vkma1: 1vkm A:1-284 [108670]
    Other proteins in same PDB: d1vkma2, d1vkmb2, d1vkmc2, d1vkmd2, d1vkme2, d1vkmf2
    Structural genomics target
    complexed with edo, mn, unl

Details for d1vkma1

PDB Entry: 1vkm (more details), 1.9 Å

PDB Description: Crystal structure of an indigoidine synthase a (idga)-like protein (tm1464) from thermotoga maritima msb8 at 1.90 A resolution
PDB Compounds: (A:) conserved hypothetical protein TM1464

SCOPe Domain Sequences for d1vkma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkma1 c.138.1.1 (A:1-284) Hypothetical protein TM1464 {Thermotoga maritima [TaxId: 2336]}
viiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfqlavigilkgkiva
gmseeeleammregadkvgtreipivvaegknaattvsatiflsrrigievvvtggtggv
hpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvgfrtnefplffsr
ksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdeierllekieleve
gkevtpfllkklvemtngrtlkanlalleenvklageiavklkr

SCOPe Domain Coordinates for d1vkma1:

Click to download the PDB-style file with coordinates for d1vkma1.
(The format of our PDB-style files is described here.)

Timeline for d1vkma1: