Lineage for d1vkka_ (1vkk A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210161Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2210162Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2210305Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 2210351Protein Glia maturation factor gamma, GMF-gamma [111110] (2 species)
  7. 2210355Species Mouse (Mus musculus) [TaxId:10090] [111111] (2 PDB entries)
    Uniprot Q9ERL7
  8. 2210356Domain d1vkka_: 1vkk A: [108669]
    Structural genomics target
    complexed with po4

Details for d1vkka_

PDB Entry: 1vkk (more details), 1.35 Å

PDB Description: Crystal structure of Glia maturation factor-gamma (GMFG) from Mus musculus at 1.50 A resolution
PDB Compounds: (A:) Glia maturation factor gamma

SCOPe Domain Sequences for d1vkka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkka_ d.109.1.2 (A:) Glia maturation factor gamma, GMF-gamma {Mouse (Mus musculus) [TaxId: 10090]}
vvcevdpelketlrkfrfrketnnaaiimkvdkdrqmvvledelqnispeelklelperq
prfvvysykyvhddgrvsyplcfifsspvgckpeqqmmyagsknrlvqtaeltkvfeirt
tddltetwlkeklaffr

SCOPe Domain Coordinates for d1vkka_:

Click to download the PDB-style file with coordinates for d1vkka_.
(The format of our PDB-style files is described here.)

Timeline for d1vkka_: