Lineage for d1vkka_ (1vkk A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509537Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 509538Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 509606Family d.109.1.2: Cofilin-like [55762] (7 proteins)
  6. 509648Protein Glia maturation factor gamma, GMF-gamma [111110] (1 species)
  7. 509649Species Mouse (Mus musculus) [TaxId:10090] [111111] (1 PDB entry)
  8. 509650Domain d1vkka_: 1vkk A: [108669]
    Structural genomics target

Details for d1vkka_

PDB Entry: 1vkk (more details), 1.35 Å

PDB Description: Crystal structure of Glia maturation factor-gamma (GMFG) from Mus musculus at 1.50 A resolution

SCOP Domain Sequences for d1vkka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkka_ d.109.1.2 (A:) Glia maturation factor gamma, GMF-gamma {Mouse (Mus musculus)}
vvcevdpelketlrkfrfrketnnaaiimkvdkdrqmvvledelqnispeelklelperq
prfvvysykyvhddgrvsyplcfifsspvgckpeqqmmyagsknrlvqtaeltkvfeirt
tddltetwlkeklaffr

SCOP Domain Coordinates for d1vkka_:

Click to download the PDB-style file with coordinates for d1vkka_.
(The format of our PDB-style files is described here.)

Timeline for d1vkka_: