Lineage for d1vkjb_ (1vkj B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484015Family c.37.1.5: PAPS sulfotransferase [52575] (12 proteins)
    Pfam 00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 484040Protein Heparan sulfate 3-O-sulfotransferase [102354] (1 species)
  7. 484041Species Mouse (Mus musculus) [TaxId:10090] [102355] (1 PDB entry)
  8. 484043Domain d1vkjb_: 1vkj B: [108667]

Details for d1vkjb_

PDB Entry: 1vkj (more details), 2.5 Å

PDB Description: crystal structure of heparan sulfate 3-o-sulfotransferase isoform 1 in the presence of pap

SCOP Domain Sequences for d1vkjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkjb_ c.37.1.5 (B:) Heparan sulfate 3-O-sulfotransferase {Mouse (Mus musculus)}
stqqlpqtiiigvrkggtrallemlslhpdvaaaenevhffdweehysqglgwyltqmpf
ssphqltvektpayftspkvperihsmnptirlllilrdpservlsdytqvlynhlqkhk
pyppiedllmrdgrlnldykalnrslyhahmlnwlrffplghihivdgdrlirdpfpeiq
kverflklspqinasnfyfnktkgfyclrdsgkdrclheskgrahpqvdpklldklheyf
hepnkkffklvgrtfdwh

SCOP Domain Coordinates for d1vkjb_:

Click to download the PDB-style file with coordinates for d1vkjb_.
(The format of our PDB-style files is described here.)

Timeline for d1vkjb_: