Lineage for d1vkia_ (1vki A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536124Fold d.116: YbaK/ProRS associated domain [55825] (1 superfamily)
    core: alpha-beta-alpha-beta(2)-(alpha-beta)2-alpha-beta(2)-alpha-beta; 3 layers; bifurcated mixed sheet
  4. 2536125Superfamily d.116.1: YbaK/ProRS associated domain [55826] (2 families) (S)
  5. 2536126Family d.116.1.1: YbaK/ProRS associated domain [55827] (4 proteins)
    Pfam PF04073
  6. 2536131Protein Hypothetical protein Atu3699 [111136] (1 species)
  7. 2536132Species Agrobacterium tumefaciens, strain C58 [TaxId:358] [111137] (1 PDB entry)
    Uniprot Q8U9M7
  8. 2536133Domain d1vkia_: 1vki A: [108664]
    Structural genomics target
    complexed with gol, so4

Details for d1vkia_

PDB Entry: 1vki (more details), 1.6 Å

PDB Description: Crystal structure of a putative oligo-nucleotide binding protein (atu3699, agr_l_2275) from agrobacterium tumefaciens str. c58 at 1.60 A resolution
PDB Compounds: (A:) hypothetical protein atu3699

SCOPe Domain Sequences for d1vkia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkia_ d.116.1.1 (A:) Hypothetical protein Atu3699 {Agrobacterium tumefaciens, strain C58 [TaxId: 358]}
srktatelfefldglgishttkqhepvftvaesqslrdlipgghtknlfvkdkkdqyfvl
tveenavvdlksvhktigaasrvsfgrpekmleylgvvpgsvtvfgaindtarqvtfvld
sdllenelvnghplsndqtttiaskdlirfleatghaplvlkvse

SCOPe Domain Coordinates for d1vkia_:

Click to download the PDB-style file with coordinates for d1vkia_.
(The format of our PDB-style files is described here.)

Timeline for d1vkia_: