Lineage for d1vkha1 (1vkh A:1-261)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135950Family c.69.1.32: Putative serine hydrolase Ydr428c [110702] (1 protein)
  6. 2135951Protein Putative serine hydrolase Ydr428c [110703] (1 species)
  7. 2135952Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110704] (1 PDB entry)
    Uniprot Q04066
  8. 2135953Domain d1vkha1: 1vkh A:1-261 [108662]
    Other proteins in same PDB: d1vkha2
    Structural genomics target
    complexed with cl, gol

Details for d1vkha1

PDB Entry: 1vkh (more details), 1.85 Å

PDB Description: crystal structure of a putative serine hydrolase (ydr428c) from saccharomyces cerevisiae at 1.85 a resolution
PDB Compounds: (A:) putative serine hydrolase

SCOPe Domain Sequences for d1vkha1:

Sequence, based on SEQRES records: (download)

>d1vkha1 c.69.1.32 (A:1-261) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msntvraispditlfnktltfqeisqntreaviyihggawndpentpndfnqlantiksm
dtestvcqysieyrlspeitnprnlydavsnitrlvkekgltninmvghsvgatfiwqil
aalkdpqekmseaqlqmlgllqivkrvflldgiyslkellieypeydcftrlafpdgiqm
yeeepsrvmpyvkkalsrfsidmhlvhsysdelltlrqtnclisclqdyqlsfklylddl
glhndvykngkvakyifdnic

Sequence, based on observed residues (ATOM records): (download)

>d1vkha1 c.69.1.32 (A:1-261) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtvraispditlfnktltfqeisqntreaviyihggawndpentpndfnqlantiksmdt
estvcqysieyrlspeitnprnlydavsnitrlvkekgltninmvghsvgatfiwqilaa
lkdpqekmseaqlqmlgllqivkrvflldgiyslkellieypeydcftrlafpdgiqmye
eepsrvmpyvkkalsrfsidmhlvhsysdelltlrqtnclisclqdyqlsfklylddlgl
hndvykngkvakyifdnic

SCOPe Domain Coordinates for d1vkha1:

Click to download the PDB-style file with coordinates for d1vkha1.
(The format of our PDB-style files is described here.)

Timeline for d1vkha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vkha2
View in 3D
Domains from other chains:
(mouse over for more information)
d1vkhb_