SCOPe 2.06: Domain d1vkfc_: 1vkf C:

Lineage for d1vkfc_ (1vkf C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.29: GlpP-like [110391] (1 family)
   automatically mapped to Pfam PF04309

5. Family c.1.29.1: GlpP-like [110392] (1 protein)
   Pfam PF04309

6. Protein Glycerol uptake operon antiterminator-related protein TM1436 [110393] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [110394] (1 PDB entry)
   Uniprot Q9X1F0

8. Domain d1vkfc_: 1vkf C: [108658]
   Structural genomics target
   complexed with cit, po4

Details for d1vkfc_

PDB Entry: 1vkf, 1.65 Å

PDB Description: crystal structure of a glycerol uptake operon antiterminator-related protein (tm1436) from thermotoga maritima msb8 at 1.65 a resolution

PDB Compounds: (C:) glycerol uptake operon antiterminator-related protein

SCOPe Domain Sequences for d1vkfc_:

Sequence; same for both SEQRES and ATOM records:

>d1vkfc_ c.1.29.1 (C:) Glycerol uptake operon antiterminator-related protein TM1436 {Thermotoga maritima [TaxId: 2336]}
mfkgiiaalwdmdsigeiepdvvfllksdilnlkfhlkilkdrgktvfvdmdfvnglgeg
eeailfvkkagadgiitikpknyvvakkngipavlrffaldskavergieqietlgvdvv
evlpgavapkvarkipgrtviaaglveteeeareilkhvsaistssrilwkmk

Timeline for d1vkfc_:

• d1vkfc_ first appeared in SCOP 1.69
  
• d1vkfc_ appears in SCOPe 2.05
  
• d1vkfc_ appears in SCOPe 2.07
  
• d1vkfc_ appears in the current release, SCOPe 2.08