Lineage for d1vkfb_ (1vkf B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2449289Superfamily c.1.29: GlpP-like [110391] (1 family) (S)
    automatically mapped to Pfam PF04309
  5. 2449290Family c.1.29.1: GlpP-like [110392] (1 protein)
    Pfam PF04309
  6. 2449291Protein Glycerol uptake operon antiterminator-related protein TM1436 [110393] (1 species)
  7. 2449292Species Thermotoga maritima [TaxId:2336] [110394] (1 PDB entry)
    Uniprot Q9X1F0
  8. 2449294Domain d1vkfb_: 1vkf B: [108657]
    Structural genomics target
    complexed with cit, po4

Details for d1vkfb_

PDB Entry: 1vkf (more details), 1.65 Å

PDB Description: crystal structure of a glycerol uptake operon antiterminator-related protein (tm1436) from thermotoga maritima msb8 at 1.65 a resolution
PDB Compounds: (B:) glycerol uptake operon antiterminator-related protein

SCOPe Domain Sequences for d1vkfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkfb_ c.1.29.1 (B:) Glycerol uptake operon antiterminator-related protein TM1436 {Thermotoga maritima [TaxId: 2336]}
mfkgiiaalwdmdsigeiepdvvfllksdilnlkfhlkilkdrgktvfvdmdfvnglgeg
eeailfvkkagadgiitikpknyvvakkngipavlrffaldskavergieqietlgvdvv
evlpgavapkvarkipgrtviaaglveteeeareilkhvsaistssrilwkmk

SCOPe Domain Coordinates for d1vkfb_:

Click to download the PDB-style file with coordinates for d1vkfb_.
(The format of our PDB-style files is described here.)

Timeline for d1vkfb_: