Lineage for d1vkfa_ (1vkf A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 574116Superfamily c.1.29: GlpP-like [110391] (1 family) (S)
  5. 574117Family c.1.29.1: GlpP-like [110392] (1 protein)
    Pfam 04309
  6. 574118Protein Glycerol uptake operon antiterminator-related protein TM1436 [110393] (1 species)
  7. 574119Species Thermotoga maritima [TaxId:243274] [110394] (1 PDB entry)
  8. 574120Domain d1vkfa_: 1vkf A: [108656]

Details for d1vkfa_

PDB Entry: 1vkf (more details), 1.65 Å

PDB Description: crystal structure of a glycerol uptake operon antiterminator-related protein (tm1436) from thermotoga maritima msb8 at 1.65 a resolution

SCOP Domain Sequences for d1vkfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkfa_ c.1.29.1 (A:) Glycerol uptake operon antiterminator-related protein TM1436 {Thermotoga maritima}
mfkgiiaalwdmdsigeiepdvvfllksdilnlkfhlkilkdrgktvfvdmdfvnglgeg
eeailfvkkagadgiitikpknyvvakkngipavlrffaldskavergieqietlgvdvv
evlpgavapkvarkipgrtviaaglveteeeareilkhvsaistssrilwkm

SCOP Domain Coordinates for d1vkfa_:

Click to download the PDB-style file with coordinates for d1vkfa_.
(The format of our PDB-style files is described here.)

Timeline for d1vkfa_: