Lineage for d1vkfa_ (1vkf A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 476919Superfamily c.1.29: GlpP-like [110391] (1 family) (S)
  5. 476920Family c.1.29.1: GlpP-like (Pfam 04309) [110392] (1 protein)
  6. 476921Protein Glycerol uptake operon antiterminator-related protein TM1436 [110393] (1 species)
  7. 476922Species Thermotoga maritima [TaxId:243274] [110394] (1 PDB entry)
  8. 476923Domain d1vkfa_: 1vkf A: [108656]

Details for d1vkfa_

PDB Entry: 1vkf (more details), 1.65 Å

PDB Description: crystal structure of a glycerol uptake operon antiterminator-related protein (tm1436) from thermotoga maritima msb8 at 1.65 a resolution

SCOP Domain Sequences for d1vkfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkfa_ c.1.29.1 (A:) Glycerol uptake operon antiterminator-related protein TM1436 {Thermotoga maritima}
mfkgiiaalwdmdsigeiepdvvfllksdilnlkfhlkilkdrgktvfvdmdfvnglgeg
eeailfvkkagadgiitikpknyvvakkngipavlrffaldskavergieqietlgvdvv
evlpgavapkvarkipgrtviaaglveteeeareilkhvsaistssrilwkm

SCOP Domain Coordinates for d1vkfa_:

Click to download the PDB-style file with coordinates for d1vkfa_.
(The format of our PDB-style files is described here.)

Timeline for d1vkfa_: