Lineage for d1vkfa_ (1vkf A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.29: GlpP-like [110391] (1 family) (S)
    automatically mapped to Pfam PF04309
  5. Family c.1.29.1: GlpP-like [110392] (1 protein)
    Pfam PF04309
  6. Protein Glycerol uptake operon antiterminator-related protein TM1436 [110393] (1 species)
  7. Species Thermotoga maritima [TaxId:2336] [110394] (1 PDB entry)
    Uniprot Q9X1F0
  8. Domain d1vkfa_: 1vkf A: [108656]
    Structural genomics target
    complexed with cit, po4

Details for d1vkfa_

PDB Entry: 1vkf (more details), 1.65 Å

PDB Description: crystal structure of a glycerol uptake operon antiterminator-related protein (tm1436) from thermotoga maritima msb8 at 1.65 a resolution
PDB Compounds: (A:) glycerol uptake operon antiterminator-related protein

SCOPe Domain Sequences for d1vkfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkfa_ c.1.29.1 (A:) Glycerol uptake operon antiterminator-related protein TM1436 {Thermotoga maritima [TaxId: 2336]}
mfkgiiaalwdmdsigeiepdvvfllksdilnlkfhlkilkdrgktvfvdmdfvnglgeg
eeailfvkkagadgiitikpknyvvakkngipavlrffaldskavergieqietlgvdvv
evlpgavapkvarkipgrtviaaglveteeeareilkhvsaistssrilwkm

SCOPe Domain Coordinates for d1vkfa_ are not available.

Timeline for d1vkfa_:

Domains from other chains:
(mouse over for more information)
d1vkfb_, d1vkfc_, d1vkfd_