Lineage for d1vked_ (1vke D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348132Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 2348133Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 2348163Family a.152.1.2: CMD-like [101468] (2 proteins)
    Pfam PF02627; hexamer of single-domain subunits
  6. 2348175Protein Hypothetical protein TM1620 [101469] (1 species)
  7. 2348176Species Thermotoga maritima [TaxId:2336] [101470] (2 PDB entries)
    Uniprot Q9X1V5
  8. 2348180Domain d1vked_: 1vke D: [108653]
    Structural genomics target
    complexed with mpd, unl

Details for d1vked_

PDB Entry: 1vke (more details), 1.56 Å

PDB Description: Crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (TM1620) from Thermotoga maritima at 1.56 A resolution
PDB Compounds: (D:) carboxymuconolactone decarboxylase family protein

SCOPe Domain Sequences for d1vked_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vked_ a.152.1.2 (D:) Hypothetical protein TM1620 {Thermotoga maritima [TaxId: 2336]}
srgtlntkrffnldsavyrpgkldvktkelmglvastvlrcddciryhlvrcvqegasde
eifealdialvvggsiviphlrravgfleelremekngeti

SCOPe Domain Coordinates for d1vked_:

Click to download the PDB-style file with coordinates for d1vked_.
(The format of our PDB-style files is described here.)

Timeline for d1vked_: