![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
![]() | Superfamily a.152.1: AhpD-like [69118] (4 families) ![]() probable biological unit contains six domains of this fold arranged with 32 symmetry |
![]() | Family a.152.1.2: CMD-like [101468] (2 proteins) Pfam PF02627; hexamer of single-domain subunits |
![]() | Protein Hypothetical protein TM1620 [101469] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [101470] (2 PDB entries) Uniprot Q9X1V5 |
![]() | Domain d1vked_: 1vke D: [108653] Structural genomics target complexed with mpd, unl |
PDB Entry: 1vke (more details), 1.56 Å
SCOPe Domain Sequences for d1vked_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vked_ a.152.1.2 (D:) Hypothetical protein TM1620 {Thermotoga maritima [TaxId: 2336]} srgtlntkrffnldsavyrpgkldvktkelmglvastvlrcddciryhlvrcvqegasde eifealdialvvggsiviphlrravgfleelremekngeti
Timeline for d1vked_: