Class b: All beta proteins [48724] (180 folds) |
Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) |
Family b.67.2.4: TM1225-like predicted glycosylases [110284] (2 proteins) Pfam PF04041 DUF377 |
Protein Hypothetical protein TM1225 [110285] (1 species) |
Species Thermotoga maritima [TaxId:2336] [110286] (1 PDB entry) Uniprot Q9X0V2 |
Domain d1vkdc_: 1vkd C: [108646] Other proteins in same PDB: d1vkda2 Structural genomics target complexed with trs |
PDB Entry: 1vkd (more details), 2.1 Å
SCOPe Domain Sequences for d1vkdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vkdc_ b.67.2.4 (C:) Hypothetical protein TM1225 {Thermotoga maritima [TaxId: 2336]} mkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsavvpyngefvgvf ridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydprvvkiedtyyitf ctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvmlnrpsdnghtpfg diflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwlliyhgvtltcngy vysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaalcdadtgrvaiyy gaadthvalafgyideivdfvkrnsm
Timeline for d1vkdc_: