Lineage for d1vkdc_ (1vkd C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807321Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2807331Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2807462Family b.67.2.4: TM1225-like predicted glycosylases [110284] (2 proteins)
    Pfam PF04041 DUF377
  6. 2807463Protein Hypothetical protein TM1225 [110285] (1 species)
  7. 2807464Species Thermotoga maritima [TaxId:2336] [110286] (1 PDB entry)
    Uniprot Q9X0V2
  8. 2807467Domain d1vkdc_: 1vkd C: [108646]
    Other proteins in same PDB: d1vkda2
    Structural genomics target
    complexed with trs

Details for d1vkdc_

PDB Entry: 1vkd (more details), 2.1 Å

PDB Description: crystal structure of a predicted glycosidase (tm1225) from thermotoga maritima msb8 at 2.10 a resolution
PDB Compounds: (C:) conserved hypothetical protein TM1225

SCOPe Domain Sequences for d1vkdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkdc_ b.67.2.4 (C:) Hypothetical protein TM1225 {Thermotoga maritima [TaxId: 2336]}
mkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsavvpyngefvgvf
ridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydprvvkiedtyyitf
ctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvmlnrpsdnghtpfg
diflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwlliyhgvtltcngy
vysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaalcdadtgrvaiyy
gaadthvalafgyideivdfvkrnsm

SCOPe Domain Coordinates for d1vkdc_:

Click to download the PDB-style file with coordinates for d1vkdc_.
(The format of our PDB-style files is described here.)

Timeline for d1vkdc_: