Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.269: Gamma-glutamyl cyclotransferase-like [110856] (1 superfamily) beta-alpha-beta(4)-alpha-beta(2); contains beta-sheet barrel (n=5, S=8) |
Superfamily d.269.1: Gamma-glutamyl cyclotransferase-like [110857] (1 family) |
Family d.269.1.1: Gamma-glutamyl cyclotransferase-like [110858] (4 proteins) Pfam PF03674 |
Protein Hypothetical protein LOC223267 [110859] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [110860] (2 PDB entries) Uniprot Q923B0 |
Domain d1vkba1: 1vkb A:1-149 [108643] Other proteins in same PDB: d1vkba2 Structural genomics target complexed with fmt |
PDB Entry: 1vkb (more details), 1.9 Å
SCOPe Domain Sequences for d1vkba1:
Sequence, based on SEQRES records: (download)
>d1vkba1 d.269.1.1 (A:1-149) Hypothetical protein LOC223267 {Mouse (Mus musculus) [TaxId: 10090]} mahifvygtlkrgqpnhkvmldhshglaafrgrgctvesfplviagehnipwllylpgkg hcvtgeiyevdeqmlrflddfedcpsmyqrtalqvqvlewegdgdpgdsvqcfvyttaty apewlflpyhesydsegphglrynprenr
>d1vkba1 d.269.1.1 (A:1-149) Hypothetical protein LOC223267 {Mouse (Mus musculus) [TaxId: 10090]} mahifvygtlkrgqpnhkvmldhshglaafrgrgctvesfplviagehnipwllylpgkg hcvtgeiyevdeqmlrflddfedcpsmyqrtalqvqvlewedpgdsvqcfvyttatyape wlflpyhesydsegphglrynprenr
Timeline for d1vkba1: