Lineage for d1vkba1 (1vkb A:1-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009334Fold d.269: Gamma-glutamyl cyclotransferase-like [110856] (1 superfamily)
    beta-alpha-beta(4)-alpha-beta(2); contains beta-sheet barrel (n=5, S=8)
  4. 3009335Superfamily d.269.1: Gamma-glutamyl cyclotransferase-like [110857] (1 family) (S)
  5. 3009336Family d.269.1.1: Gamma-glutamyl cyclotransferase-like [110858] (4 proteins)
    Pfam PF03674
  6. 3009337Protein Hypothetical protein LOC223267 [110859] (1 species)
  7. 3009338Species Mouse (Mus musculus) [TaxId:10090] [110860] (2 PDB entries)
    Uniprot Q923B0
  8. 3009339Domain d1vkba1: 1vkb A:1-149 [108643]
    Other proteins in same PDB: d1vkba2
    Structural genomics target
    complexed with fmt

Details for d1vkba1

PDB Entry: 1vkb (more details), 1.9 Å

PDB Description: crystal structure of an aig2-like protein (a2ld1, ggact, mgc7867) from mus musculus at 1.90 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1vkba1:

Sequence, based on SEQRES records: (download)

>d1vkba1 d.269.1.1 (A:1-149) Hypothetical protein LOC223267 {Mouse (Mus musculus) [TaxId: 10090]}
mahifvygtlkrgqpnhkvmldhshglaafrgrgctvesfplviagehnipwllylpgkg
hcvtgeiyevdeqmlrflddfedcpsmyqrtalqvqvlewegdgdpgdsvqcfvyttaty
apewlflpyhesydsegphglrynprenr

Sequence, based on observed residues (ATOM records): (download)

>d1vkba1 d.269.1.1 (A:1-149) Hypothetical protein LOC223267 {Mouse (Mus musculus) [TaxId: 10090]}
mahifvygtlkrgqpnhkvmldhshglaafrgrgctvesfplviagehnipwllylpgkg
hcvtgeiyevdeqmlrflddfedcpsmyqrtalqvqvlewedpgdsvqcfvyttatyape
wlflpyhesydsegphglrynprenr

SCOPe Domain Coordinates for d1vkba1:

Click to download the PDB-style file with coordinates for d1vkba1.
(The format of our PDB-style files is described here.)

Timeline for d1vkba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vkba2