SCOPe 2.08: Domain d1vkba1: 1vkb A:1-149

Lineage for d1vkba1 (1vkb A:1-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.269: Gamma-glutamyl cyclotransferase-like [110856] (1 superfamily)
   beta-alpha-beta(4)-alpha-beta(2); contains beta-sheet barrel (n=5, S=8)

4. Superfamily d.269.1: Gamma-glutamyl cyclotransferase-like [110857] (1 family)

5. Family d.269.1.1: Gamma-glutamyl cyclotransferase-like [110858] (4 proteins)
   Pfam PF03674

6. Protein Hypothetical protein LOC223267 [110859] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [110860] (2 PDB entries)
   Uniprot Q923B0

8. Domain d1vkba1: 1vkb A:1-149 [108643]
   Other proteins in same PDB: d1vkba2
   Structural genomics target
   complexed with fmt

Details for d1vkba1

PDB Entry: 1vkb, 1.9 Å

PDB Description: crystal structure of an aig2-like protein (a2ld1, ggact, mgc7867) from mus musculus at 1.90 a resolution

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1vkba1:

Sequence, based on SEQRES records:

>d1vkba1 d.269.1.1 (A:1-149) Hypothetical protein LOC223267 {Mouse (Mus musculus) [TaxId: 10090]}
mahifvygtlkrgqpnhkvmldhshglaafrgrgctvesfplviagehnipwllylpgkg
hcvtgeiyevdeqmlrflddfedcpsmyqrtalqvqvlewegdgdpgdsvqcfvyttaty
apewlflpyhesydsegphglrynprenr

Sequence, based on observed residues (ATOM records):

>d1vkba1 d.269.1.1 (A:1-149) Hypothetical protein LOC223267 {Mouse (Mus musculus) [TaxId: 10090]}
mahifvygtlkrgqpnhkvmldhshglaafrgrgctvesfplviagehnipwllylpgkg
hcvtgeiyevdeqmlrflddfedcpsmyqrtalqvqvlewedpgdsvqcfvyttatyape
wlflpyhesydsegphglrynprenr

Timeline for d1vkba1:

• d1vkba1 first appeared in SCOP 1.69, called d1vkba_
  
• d1vkba1 appears in SCOPe 2.07