Lineage for d1vkab_ (1vka B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443178Fold a.40: CH domain-like [47575] (2 superfamilies)
    core: 4 helices: bundle
  4. 443179Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (1 family) (S)
  5. 443180Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (9 proteins)
    Pfam 00307
  6. 443217Protein Microtubule-associated protein eb1, N-terminal microtubule binding domain [101194] (2 species)
    member of rp/eb family
  7. 443218Species Human (Homo sapiens) [TaxId:9606] [101195] (3 PDB entries)
  8. 443221Domain d1vkab_: 1vka B: [108642]
    Structural genomics target

Details for d1vkab_

PDB Entry: 1vka (more details), 1.6 Å

PDB Description: southeast collaboratory for structural genomics: hypothetical human protein q15691 n-terminal fragment

SCOP Domain Sequences for d1vkab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkab_ a.40.1.1 (B:) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens)}
avnvystsvtsdnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkv
kfqakleheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanydg
kdydpvaar

SCOP Domain Coordinates for d1vkab_:

Click to download the PDB-style file with coordinates for d1vkab_.
(The format of our PDB-style files is described here.)

Timeline for d1vkab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vkaa_