SCOP 1.69: Domain d1vkab_: 1vka B:

Lineage for d1vkab_ (1vka B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.40: CH domain-like [47575] (2 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (1 family)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (9 proteins)
   Pfam 00307

6. Protein Microtubule-associated protein eb1, N-terminal microtubule binding domain [101194] (2 species)
   member of rp/eb family

7. Species Human (Homo sapiens) [TaxId:9606] [101195] (3 PDB entries)

8. Domain d1vkab_: 1vka B: [108642]
   Structural genomics target

Details for d1vkab_

PDB Entry: 1vka, 1.6 Å

PDB Description: southeast collaboratory for structural genomics: hypothetical human protein q15691 n-terminal fragment

SCOP Domain Sequences for d1vkab_:

Sequence; same for both SEQRES and ATOM records:

>d1vkab_ a.40.1.1 (B:) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens)}
avnvystsvtsdnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkv
kfqakleheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanydg
kdydpvaar

Timeline for d1vkab_:

• d1vkab_ is new in SCOP 1.69
  
• d1vkab_ appears in SCOP 1.71
  
• d1vkab_ appears in the current release, SCOPe 2.08