Lineage for d1vkaa1 (1vka A:2-132)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712024Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 2712062Protein Microtubule-associated protein eb1, N-terminal microtubule binding domain [101194] (2 species)
    member of rp/eb family
  7. 2712063Species Human (Homo sapiens) [TaxId:9606] [101195] (5 PDB entries)
    Uniprot Q15691 2-132
  8. 2712068Domain d1vkaa1: 1vka A:2-132 [108641]
    Other proteins in same PDB: d1vkaa2
    Structural genomics target

Details for d1vkaa1

PDB Entry: 1vka (more details), 1.6 Å

PDB Description: southeast collaboratory for structural genomics: hypothetical human protein q15691 n-terminal fragment
PDB Compounds: (A:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d1vkaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkaa1 a.40.1.1 (A:2-132) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]}
avnvystsvtsdnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkv
kfqakleheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanydg
kdydpvaarqg

SCOPe Domain Coordinates for d1vkaa1:

Click to download the PDB-style file with coordinates for d1vkaa1.
(The format of our PDB-style files is described here.)

Timeline for d1vkaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vkaa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1vkab_