SCOPe 2.07: Domain d1vk9a1: 1vk9 A:1-136

Lineage for d1vk9a1 (1vk9 A:1-136)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.3: Hypothetical protein TM1506 [110651] (1 protein)
   strand 5 is parallel to strand 4
   automatically mapped to Pfam PF08973

6. Protein Hypothetical protein TM1506 [110652] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [110653] (1 PDB entry)
   Uniprot Q9X1J4

8. Domain d1vk9a1: 1vk9 A:1-136 [108640]
   Other proteins in same PDB: d1vk9a2
   Structural genomics target
   complexed with unl, zn

Details for d1vk9a1

PDB Entry: 1vk9, 2.7 Å

PDB Description: crystal structure of a duf1893 family protein (tm1506) from thermotoga maritima at 2.70 a resolution

PDB Compounds: (A:) conserved hypothetical protein TM1506

SCOPe Domain Sequences for d1vk9a1:

Sequence; same for both SEQRES and ATOM records:

>d1vk9a1 c.97.1.3 (A:1-136) Hypothetical protein TM1506 {Thermotoga maritima [TaxId: 2336]}
veknllrsalkifekkdlsllaysgrsifeskdsglkpvvelfkrfdnlegslvidkmvg
kaaasfllkmkpdhihakviskpalklmneygqsfsydekipfvlgkdgksmcpfeklvl
emddpeeiirivlskf

Timeline for d1vk9a1:

• d1vk9a1 first appeared in SCOP 1.69, called d1vk9a_
  
• d1vk9a1 appears in SCOPe 2.06
  
• d1vk9a1 appears in the current release, SCOPe 2.08