SCOP 1.69: Domain d1vk9a_: 1vk9 A:

Lineage for d1vk9a_ (1vk9 A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.139: Hypothetical protein TM1506 [110649] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 1 is antiparallel to the rest

4. Superfamily c.139.1: Hypothetical protein TM1506 [110650] (1 family)

5. Family c.139.1.1: Hypothetical protein TM1506 [110651] (1 protein)

6. Protein Hypothetical protein TM1506 [110652] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [110653] (1 PDB entry)

8. Domain d1vk9a_: 1vk9 A: [108640]
   Structural genomics target

Details for d1vk9a_

PDB Entry: 1vk9, 2.7 Å

PDB Description: crystal structure of a duf1893 family protein (tm1506) from thermotoga maritima at 2.70 a resolution

SCOP Domain Sequences for d1vk9a_:

Sequence; same for both SEQRES and ATOM records:

>d1vk9a_ c.139.1.1 (A:) Hypothetical protein TM1506 {Thermotoga maritima}
gsdkihhhhhhveknllrsalkifekkdlsllaysgrsifeskdsglkpvvelfkrfdnl
egslvidkmvgkaaasfllkmkpdhihakviskpalklmneygqsfsydekipfvlgkdg
ksmcpfeklvlemddpeeiirivlskf

Timeline for d1vk9a_:

• d1vk9a_ is new in SCOP 1.69
  
• d1vk9a_ appears in SCOP 1.71
  
• d1vk9a_ appears in the current release, SCOPe 2.08, called d1vk9a1