![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.3: Hypothetical protein TM1506 [110651] (1 protein) strand 5 is parallel to strand 4 automatically mapped to Pfam PF08973 |
![]() | Protein Hypothetical protein TM1506 [110652] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [110653] (1 PDB entry) Uniprot Q9X1J4 |
![]() | Domain d1vk9a1: 1vk9 A:1-136 [108640] Other proteins in same PDB: d1vk9a2 Structural genomics target complexed with unl, zn |
PDB Entry: 1vk9 (more details), 2.7 Å
SCOPe Domain Sequences for d1vk9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vk9a1 c.97.1.3 (A:1-136) Hypothetical protein TM1506 {Thermotoga maritima [TaxId: 2336]} veknllrsalkifekkdlsllaysgrsifeskdsglkpvvelfkrfdnlegslvidkmvg kaaasfllkmkpdhihakviskpalklmneygqsfsydekipfvlgkdgksmcpfeklvl emddpeeiirivlskf
Timeline for d1vk9a1: