Lineage for d1vk9a1 (1vk9 A:1-136)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918660Family c.97.1.3: Hypothetical protein TM1506 [110651] (1 protein)
    strand 5 is parallel to strand 4
    automatically mapped to Pfam PF08973
  6. 2918661Protein Hypothetical protein TM1506 [110652] (1 species)
  7. 2918662Species Thermotoga maritima [TaxId:2336] [110653] (1 PDB entry)
    Uniprot Q9X1J4
  8. 2918663Domain d1vk9a1: 1vk9 A:1-136 [108640]
    Other proteins in same PDB: d1vk9a2
    Structural genomics target
    complexed with unl, zn

Details for d1vk9a1

PDB Entry: 1vk9 (more details), 2.7 Å

PDB Description: crystal structure of a duf1893 family protein (tm1506) from thermotoga maritima at 2.70 a resolution
PDB Compounds: (A:) conserved hypothetical protein TM1506

SCOPe Domain Sequences for d1vk9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vk9a1 c.97.1.3 (A:1-136) Hypothetical protein TM1506 {Thermotoga maritima [TaxId: 2336]}
veknllrsalkifekkdlsllaysgrsifeskdsglkpvvelfkrfdnlegslvidkmvg
kaaasfllkmkpdhihakviskpalklmneygqsfsydekipfvlgkdgksmcpfeklvl
emddpeeiirivlskf

SCOPe Domain Coordinates for d1vk9a1:

Click to download the PDB-style file with coordinates for d1vk9a1.
(The format of our PDB-style files is described here.)

Timeline for d1vk9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vk9a2