![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.48: MTH1187/YkoF-like [89957] (2 families) ![]() |
![]() | Family d.58.48.1: MTH1187-like [89958] (5 proteins) Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix |
![]() | Protein Hypothetical protein TM0486 [110985] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [110986] (1 PDB entry) |
![]() | Domain d1vk8d_: 1vk8 D: [108639] Structural genomics target complexed with unl |
PDB Entry: 1vk8 (more details), 1.8 Å
SCOP Domain Sequences for d1vk8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vk8d_ d.58.48.1 (D:) Hypothetical protein TM0486 {Thermotoga maritima [TaxId: 2336]} pkvtvsikvvpavedgrlhevidraiekisswgmkyevgpsnttvegefeeimdrvkela ryleqfakrfvlqldidykaggitieekvskyr
Timeline for d1vk8d_: