Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.48: MTH1187/YkoF-like [89957] (2 families) |
Family d.58.48.1: MTH1187-like [89958] (5 proteins) Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix |
Protein Hypothetical protein TM0486 [110985] (1 species) |
Species Thermotoga maritima [TaxId:2336] [110986] (1 PDB entry) Uniprot Q9WYV6 |
Domain d1vk8c_: 1vk8 C: [108638] Structural genomics target |
PDB Entry: 1vk8 (more details), 1.8 Å
SCOP Domain Sequences for d1vk8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vk8c_ d.58.48.1 (C:) Hypothetical protein TM0486 {Thermotoga maritima [TaxId: 2336]} mpkvtvsikvvpavedgrlhevidraiekisswgmkyevgpsnttvegefeeimdrvkel aryleqfakrfvlqldidykaggitieekvskyr
Timeline for d1vk8c_: